RMI1 Antikörper

Produktnummer ABIN634128

Produktdetails anti-RMI1 Antikörper

Target: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RMI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RMI1 Blocking Peptide, catalog no. 33R-1953, is also available for use as a blocking control in assays to test for specificity of this RMI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RMI1

Target: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Andere Bezeichnung: RMI1 (RMI1 Produkte)

Synonyme: BLAP75 antikoerper, C9orf76 antikoerper, FAAP75 antikoerper, RP11-346I8.1 antikoerper, RGD1310671 antikoerper, 4932432N11Rik antikoerper, C79893 antikoerper, MGC55882 antikoerper, zgc:55882 antikoerper, RecQ mediated genome instability 1 antikoerper, RecQ mediated genome instability 1 L homeolog antikoerper, RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) antikoerper, RMI1 antikoerper, Rmi1 antikoerper, rmi1.L antikoerper, rmi1 antikoerper

Hintergrund: RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: DNA Reparatur