GSPT2 Antikörper (N-Term)

Produktnummer ABIN634138

Produktdetails anti-GSPT2 Antikörper

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSPT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSPT2 antibody was raised against the N terminal of GSPT2

Aufreinigung: Affinity purified

Immunogen: GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSPT2 Blocking Peptide, catalog no. 33R-5685, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSPT2

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Andere Bezeichnung: GSPT2 (GSPT2 Produkte)

Synonyme: ERF3B antikoerper, GST2 antikoerper, G1 to S phase transition 2 antikoerper, GSPT2 antikoerper, Gspt2 antikoerper

Hintergrund: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells.

Molekulargewicht: 69 kDa (MW of target protein)