Septin 11 Antikörper (N-Term)

Produktnummer ABIN634141

Produktdetails anti-Septin 11 Antikörper

Target: Septin 11 (SEPT11)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Septin 11 antibody was raised against the N terminal of 40432

Aufreinigung: Affinity purified

Immunogen: Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Septin 11 Blocking Peptide, catalog no. 33R-5793, is also available for use as a blocking control in assays to test for specificity of this Septin 11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40787 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 11

Target: Septin 11 (SEPT11)

Andere Bezeichnung: Septin 11 (SEPT11 Produkte)

Synonyme: 6230410I01Rik antikoerper, AW548875 antikoerper, D5Ertd606e antikoerper, Sept6 antikoerper, Sep-11 antikoerper, MGC81799 antikoerper, SEPT11 antikoerper, Septin-11 antikoerper, septin 11 antikoerper, septin 11 S homeolog antikoerper, SEPT11 antikoerper, Sept11 antikoerper, sept11.S antikoerper

Hintergrund: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Molekulargewicht: 49 kDa (MW of target protein)