ORC4 Antikörper
-
- Target Alle ORC4 Antikörper anzeigen
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ORC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
- Top Product
- Discover our top product ORC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
- Andere Bezeichnung
- ORC4L (ORC4 Produkte)
- Synonyme
- ORC4L antikoerper, ORC4P antikoerper, Orc4P antikoerper, Orc4l antikoerper, mMmORC4 antikoerper, CG2917 antikoerper, DmORC4 antikoerper, Dmel\\CG2917 antikoerper, ORC antikoerper, ORC4 antikoerper, dmOrc4 antikoerper, orc4 antikoerper, rDmORC antikoerper, orc4l antikoerper, fc50c03 antikoerper, wu:fc50c03 antikoerper, zgc:85772 antikoerper, ATORC4 antikoerper, F23H14.9 antikoerper, F23H14_9 antikoerper, ORIGIN RECOGNITION COMPLEX SUBUNIT 4 antikoerper, origin recognition complex subunit 4 antikoerper, origin recognition complex subunit 4 antikoerper, origin recognition complex, subunit 4 antikoerper, Origin recognition complex subunit 4 antikoerper, origin recognition complex subunit 4 L homeolog antikoerper, origin recognition complex subunit Orc4 antikoerper, ORC4 antikoerper, Orc4 antikoerper, orc4.L antikoerper, orc4 antikoerper, CNM01830 antikoerper
- Hintergrund
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-