BTG4 Antikörper (Middle Region)
-
- Target Alle BTG4 Antikörper anzeigen
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BTG4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BTG4 antibody was raised against the middle region of BTG4
- Aufreinigung
- Affinity purified
- Immunogen
- BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
- Top Product
- Discover our top product BTG4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
- Andere Bezeichnung
- BTG4 (BTG4 Produkte)
- Synonyme
- SCIR-27 antikoerper, b9-a antikoerper, pc3b antikoerper, C86116 antikoerper, PC3B antikoerper, BTG anti-proliferation factor 4 antikoerper, BTG family member 4 L homeolog antikoerper, B cell translocation gene 4 antikoerper, Btg4 antikoerper, btg4.L antikoerper, BTG4 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
- Molekulargewicht
- 26 kDa (MW of target protein)
-