CHEK1 Antikörper

Produktnummer ABIN634171

Produktdetails anti-CHEK1 Antikörper

Target: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHEK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHEK1 Blocking Peptide, catalog no. 33R-10008, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHEK1

Target: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Andere Bezeichnung: CHEK1 (CHEK1 Produkte)

Hintergrund: CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: p53 Signalweg, Apoptose, Zellzyklus, DNA Reparatur