KIF5B Antikörper (N-Term)

Produktnummer ABIN634172

Produktdetails anti-KIF5B Antikörper

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIF5 B antibody was raised against the N terminal of KIF5

Aufreinigung: Affinity purified

Immunogen: KIF5 B antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF5B Blocking Peptide, catalog no. 33R-1753, is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF5B

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Andere Bezeichnung: KIF5B (KIF5B Produkte)

Hintergrund: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Ribonucleoprotein Complex Subunit Organization