KIF5B Antikörper (N-Term)

Produktnummer ABIN634172

Produktdetails anti-KIF5B Antikörper

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIF5 B antibody was raised against the N terminal of KIF5

Aufreinigung: Affinity purified

Immunogen: KIF5 B antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF5B Blocking Peptide, catalog no. 33R-1753, is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF5B

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Andere Bezeichnung: KIF5B (KIF5B Produkte)

Synonyme: KINH antikoerper, KNS antikoerper, KNS1 antikoerper, UKHC antikoerper, Khc antikoerper, AL022807 antikoerper, Khcs antikoerper, Kns1 antikoerper, Ukhc antikoerper, khc antikoerper, KIF5A antikoerper, kinesin family member 5B antikoerper, kinesin heavy chain antikoerper, kinesin-1 antikoerper, kinesin-1 heavy chain antikoerper, kinesin family member 5B S homeolog antikoerper, KIF5B antikoerper, LOC411769 antikoerper, cgd6_2790 antikoerper, kin-1 antikoerper, Tb927.1.1350 antikoerper, LACBIDRAFT_305999 antikoerper, Khc antikoerper, LOC100538629 antikoerper, Kif5b antikoerper, kif5b.S antikoerper

Hintergrund: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Ribonucleoprotein Complex Subunit Organization