KIFC3 Antikörper (C-Term)
-
- Target Alle KIFC3 Antikörper anzeigen
- KIFC3 (Kinesin Family Member C3 (KIFC3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIFC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIFC3 antibody was raised against the C terminal of KIFC3
- Aufreinigung
- Affinity purified
- Immunogen
- KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
- Top Product
- Discover our top product KIFC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIFC3 Blocking Peptide, catalog no. 33R-2452, is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIFC3 (Kinesin Family Member C3 (KIFC3))
- Andere Bezeichnung
- KIFC3 (KIFC3 Produkte)
- Hintergrund
- KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.
- Molekulargewicht
- 93 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-