ORC6 Antikörper
-
- Target Alle ORC6 Antikörper anzeigen
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ORC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ORC6 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE
- Top Product
- Discover our top product ORC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ORC6L Blocking Peptide, catalog no. 33R-9488, is also available for use as a blocking control in assays to test for specificity of this ORC6L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
- Andere Bezeichnung
- ORC6L (ORC6 Produkte)
- Synonyme
- Orc6l antikoerper, CG1584 antikoerper, DmORC 6 antikoerper, DmORC6 antikoerper, Dmel\\CG1584 antikoerper, ORC antikoerper, ORC6 antikoerper, orc6 antikoerper, rDmORC antikoerper, ORC6L antikoerper, ARABIDOPSIS THALIANA ORIGIN RECOGNITION COMPLEX PROTEIN 6 antikoerper, ATORC6 antikoerper, ORIGIN RECOGNITION COMPLEX SUBUNIT 6 antikoerper, T2P11.3 antikoerper, T2P11_3 antikoerper, origin recognition complex protein 6 antikoerper, DDBDRAFT_0186183 antikoerper, DDBDRAFT_0233113 antikoerper, DDB_0186183 antikoerper, DDB_0233113 antikoerper, LOC100284755 antikoerper, orc6l antikoerper, 6720420I10Rik antikoerper, origin recognition complex, subunit 6 antikoerper, Origin recognition complex subunit 6 antikoerper, origin recognition complex subunit 6 antikoerper, origin recognition complex protein 6 antikoerper, origin recognition complex subunit Orc6 antikoerper, Orc6 antikoerper, ORC6 antikoerper, CpipJ_CPIJ005016 antikoerper, SJAG_01267 antikoerper, orcF antikoerper, LOC100284755 antikoerper, orc6 antikoerper
- Hintergrund
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. gene silencing.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, M Phase, Synthesis of DNA
-