SYCP1 Antikörper (N-Term)
-
- Target Alle SYCP1 Antikörper anzeigen
- SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SYCP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SYCP1 antibody was raised against the N terminal of SYCP1
- Aufreinigung
- Affinity purified
- Immunogen
- SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
- Top Product
- Discover our top product SYCP1 Primärantikörper
-
anti-Synaptonemal Complex Protein 1 (SYCP1) antibody
SYCP1 Reaktivität: Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (C-Term) antibodySYCP1 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (AA 72-121) antibodySYCP1 Reaktivität: Human, Maus, Ratte, Meerschweinchen WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) antibodySYCP1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (AA 51-150) antibodySYCP1 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (AA 927-955), (C-Term) antibodySYCP1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37284 unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (C-Term) antibodySYCP1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (AA 100-400) antibodySYCP1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (N-Term) antibodySYCP1 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Synaptonemal Complex Protein 1 (SYCP1) (C-Term) antibodySYCP1 Reaktivität: Maus, Ratte IHC (p), IF, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SYCP1 Blocking Peptide, catalog no. 33R-6689, is also available for use as a blocking control in assays to test for specificity of this SYCP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))
- Andere Bezeichnung
- SYCP1 (SYCP1 Produkte)
- Synonyme
- CT8 antikoerper, HOM-TES-14 antikoerper, SCP1 antikoerper, SYCP1 antikoerper, T16E15.12 antikoerper, T16E15_12 antikoerper, ZYP1 antikoerper, sycp1 antikoerper, SCP-1 antikoerper, syn1 antikoerper, synaptonemal complex protein 1 antikoerper, Myosin heavy chain-related protein antikoerper, SYCP1 antikoerper, sycp1 antikoerper, ZYP1a antikoerper, Sycp1 antikoerper
- Hintergrund
- SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.
- Molekulargewicht
- 107 kDa (MW of target protein)
-
