NUP98 Antikörper (N-Term)

Produktnummer ABIN634181

Produktdetails anti-NUP98 Antikörper

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP98 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUP98 antibody was raised against the N terminal of NUP98

Aufreinigung: Affinity purified

Immunogen: NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP98

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Andere Bezeichnung: NUP98 (NUP98 Produkte)

Synonyme: CG10198 antikoerper, CG10201 antikoerper, Dmel\\CG10198 antikoerper, Nup 96 antikoerper, Nup 98 antikoerper, Nup-98 antikoerper, Nup96 antikoerper, Nup98 antikoerper, Nup98-Nup96 antikoerper, Nup98/96 antikoerper, l(3)95BCd antikoerper, nup145 antikoerper, nup98-96 antikoerper, GB12688 antikoerper, NUP98 antikoerper, 4732457F17 antikoerper, AI849286 antikoerper, im:7151238 antikoerper, zgc:113968 antikoerper, zgc:63593 antikoerper, ADIR2 antikoerper, NUP196 antikoerper, NUP96 antikoerper, Nucleoporin 98-96kD antikoerper, nuclear pore complex protein Nup98-Nup96 antikoerper, nucleoporin 98 antikoerper, nucleoporin 98kDa antikoerper, nucleoporin 98 L homeolog antikoerper, Nup98-96 antikoerper, LOC408335 antikoerper, NUP98 antikoerper, LOC587580 antikoerper, Nup98 antikoerper, nup98 antikoerper, nup98.L antikoerper

Hintergrund: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interaktom