SET/TAF-I Antikörper (N-Term)

Produktnummer ABIN634191

Produktdetails anti-SET/TAF-I Antikörper

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SET/TAF-I Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SET antibody was raised against the N terminal of SET

Aufreinigung: Affinity purified

Immunogen: SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SET Blocking Peptide, catalog no. 33R-3911, is also available for use as a blocking control in assays to test for specificity of this SET antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SET antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SET/TAF-I

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Andere Bezeichnung: SET (SET Produkte)

Synonyme: 2PP2A antikoerper, I2PP2A antikoerper, IGAAD antikoerper, IPP2A2 antikoerper, PHAPII antikoerper, TAF-I antikoerper, TAF-IBETA antikoerper, 2610030F17Rik antikoerper, 5730420M11Rik antikoerper, AA407739 antikoerper, I-2PP2A antikoerper, StF-IT-1 antikoerper, 2pp2a antikoerper, i2pp2a antikoerper, igaad antikoerper, ipp2a2 antikoerper, phapii antikoerper, set antikoerper, set-a antikoerper, set-b antikoerper, taf-ibeta antikoerper, wu:fb30g11 antikoerper, wu:fd16c08 antikoerper, SET nuclear proto-oncogene antikoerper, SET nuclear oncogene antikoerper, SET translocation antikoerper, SET nuclear proto-oncogene L homeolog antikoerper, SET nuclear proto-oncogene b antikoerper, SET antikoerper, Set antikoerper, LOC403555 antikoerper, set.L antikoerper, setb antikoerper

Hintergrund: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Apoptose