MOS Antikörper (Middle Region)
-
- Target Alle MOS Antikörper anzeigen
- MOS (Moloney Sarcoma Oncogene (MOS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MOS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MOS antibody was raised against the middle region of MOS
- Aufreinigung
- Affinity purified
- Immunogen
- MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
- Top Product
- Discover our top product MOS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MOS Blocking Peptide, catalog no. 33R-5250, is also available for use as a blocking control in assays to test for specificity of this MOS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOS (Moloney Sarcoma Oncogene (MOS))
- Andere Bezeichnung
- MOS (MOS Produkte)
- Synonyme
- MOS antikoerper, c-mos antikoerper, msv antikoerper, p39 antikoerper, mosxe antikoerper, MSV antikoerper, p39-mos antikoerper, MOS proto-oncogene, serine/threonine kinase antikoerper, v-mos Moloney murine sarcoma viral oncogene homolog antikoerper, serine/threonine-protein kinase mos-like antikoerper, Moloney sarcoma oncogene antikoerper, MOS proto-oncogene, serine/threonine kinase L homeolog antikoerper, MOS antikoerper, mos antikoerper, LOC100229612 antikoerper, Mos antikoerper, mos.L antikoerper
- Hintergrund
- MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.
- Molekulargewicht
- 38 kDa (MW of target protein)
-