Septin 2 Antikörper (N-Term)

Produktnummer ABIN634205

Produktdetails anti-Septin 2 Antikörper

Target: Septin 2 (SEPT2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Septin 2 antibody was raised against the N terminal of 40423

Aufreinigung: Affinity purified

Immunogen: Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Septin 2 Blocking Peptide, catalog no. 33R-6451, is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 37500 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 2

Target: Septin 2 (SEPT2)

Andere Bezeichnung: Septin 2 (SEPT2 Produkte)

Synonyme: DIFF6 antikoerper, NEDD5 antikoerper, Pnutl3 antikoerper, hNedd5 antikoerper, AW208991 antikoerper, Nedd-5 antikoerper, Nedd5 antikoerper, mKIAA0158 antikoerper, Vesp11 antikoerper, nedd5 antikoerper, wu:fb52g01 antikoerper, wu:fb99a01 antikoerper, Septin-2A antikoerper, Septin-A antikoerper, diff6 antikoerper, pnutl3 antikoerper, sept2 antikoerper, septa antikoerper, xlsepta antikoerper, SEPT2 antikoerper, Sep-02 antikoerper, Septin-2B antikoerper, hnedd5 antikoerper, sept2-B antikoerper, Septin-2 antikoerper, septin 2 antikoerper, septin 2 L homeolog antikoerper, septin 2-like antikoerper, COG1487; VapC; putative nucleic acid-binding protein; contains PIN domain antikoerper, septin 2 S homeolog antikoerper, SEPT2 antikoerper, Sept2 antikoerper, sept2 antikoerper, sept2.L antikoerper, SEPT2L antikoerper, sepT2 antikoerper, sept2.S antikoerper

Hintergrund: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Molekulargewicht: 41 kDa (MW of target protein)