CCNYL1 Antikörper (N-Term)
-
- Target Alle CCNYL1 Antikörper anzeigen
- CCNYL1 (Cyclin Y-Like 1 (CCNYL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCNYL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1
- Aufreinigung
- Affinity purified
- Immunogen
- Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF
- Top Product
- Discover our top product CCNYL1 Primärantikörper
-
anti-Cyclin Y-Like 1 (CCNYL1) (AA 41-70), (N-Term) antibody
CCNYL1 Reaktivität: Human, Hamster WB, IHC (p) Wirt: Kaninchen Polyclonal RB27113 unconjugated
anti-Cyclin Y-Like 1 (CCNYL1) (AA 71-120) antibodyCCNYL1 Reaktivität: Human, Maus, Kaninchen, Hund, Ziege, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cyclin Y-Like 1 Blocking Peptide, catalog no. 33R-9359, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNYL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCNYL1 (Cyclin Y-Like 1 (CCNYL1))
- Andere Bezeichnung
- Cyclin Y-Like 1 (CCNYL1 Produkte)
- Synonyme
- 9630037P07Rik antikoerper, AW554339 antikoerper, RGD1310683 antikoerper, ccnyl1 antikoerper, MGC153047 antikoerper, wu:fi41h04 antikoerper, CH1073-226M24.2 antikoerper, cyclin Y like 1 antikoerper, cyclin Y-like 1 antikoerper, microRNA 4775 antikoerper, cyclin Y like 1 L homeolog antikoerper, cyclin Y like 1 S homeolog antikoerper, CCNYL1 antikoerper, Ccnyl1 antikoerper, MIR4775 antikoerper, ccnyl1.L antikoerper, ccnyl1.S antikoerper, ccnyl1 antikoerper
- Hintergrund
- The specific function of CCNYL1 is not yet known.
- Molekulargewicht
- 33 kDa (MW of target protein)
-
