TUBE1 Antikörper (Middle Region)

Produktnummer ABIN634213

Produktdetails anti-TUBE1 Antikörper

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Aufreinigung: Affinity purified

Immunogen: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Epsilon Tubulin 1 Blocking Peptide, catalog no. 33R-3777, is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBE1

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Andere Bezeichnung: epsilon Tubulin 1 (TUBE1 Produkte)

Synonyme: zgc:63582 antikoerper, LOC398412 antikoerper, TUBE1 antikoerper, tube antikoerper, 2310061K05Rik antikoerper, AI551343 antikoerper, Tube antikoerper, TUBE antikoerper, dJ142L7.2 antikoerper, tubulin, epsilon 1 antikoerper, tubulin epsilon 1 L homeolog antikoerper, tubulin epsilon 1 antikoerper, epsilon tubulin antikoerper, putative epsilon tubulin antikoerper, Epsilon tubulin antikoerper, tubulin epsilon chain antikoerper, epsilon-tubulin 1 antikoerper, tube1 antikoerper, tube1.L antikoerper, TUBE1 antikoerper, Tc00.1047053509967.160 antikoerper, Tc00.1047053509695.120 antikoerper, Tb10.70.6950 antikoerper, LMJF_21_1010 antikoerper, GL50803_6336 antikoerper, TUE antikoerper, tubE antikoerper, LOC100541905 antikoerper, Tube1 antikoerper

Hintergrund: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Microtubule Dynamics