DKC1 Antikörper (N-Term)

Produktnummer ABIN634217

Produktdetails anti-DKC1 Antikörper

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DKC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DKC1 antibody was raised against the N terminal of DKC1

Aufreinigung: Affinity purified

Immunogen: DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKC1 Blocking Peptide, catalog no. 33R-2407, is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DKC1

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Andere Bezeichnung: DKC1 (DKC1 Produkte)

Synonyme: CBF5 antikoerper, DKC antikoerper, DKCX antikoerper, NAP57 antikoerper, NOLA4 antikoerper, XAP101 antikoerper, dyskerin antikoerper, fv62a07 antikoerper, wu:fa28f10 antikoerper, wu:fc87a02 antikoerper, wu:fi24a05 antikoerper, wu:fv62a07 antikoerper, zgc:110395 antikoerper, DKC1 antikoerper, cbf5 antikoerper, dkc antikoerper, nap57 antikoerper, nola4 antikoerper, xap101 antikoerper, BC068171 antikoerper, Nap57 antikoerper, AtCBF5 antikoerper, AtNAP57 antikoerper, homologue of NAP57 antikoerper, dyskerin pseudouridine synthase 1 antikoerper, microRNA 664b antikoerper, dyskeratosis congenita 1, dyskerin antikoerper, dyskeratosis congenita 1, dyskerin L homeolog antikoerper, homologue of NAP57 antikoerper, DKC1 antikoerper, MIR664B antikoerper, dkc1 antikoerper, dkc1.L antikoerper, Dkc1 antikoerper, NAP57 antikoerper

Hintergrund: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance