DHX16 Antikörper
-
- Target Alle DHX16 Antikörper anzeigen
- DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
- Top Product
- Discover our top product DHX16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))
- Andere Bezeichnung
- DHX16 (DHX16 Produkte)
- Synonyme
- fa91b12 antikoerper, zgc:55590 antikoerper, wu:fa91b12 antikoerper, dbp2 antikoerper, ddx16 antikoerper, pro2014 antikoerper, prp2 antikoerper, prp8 antikoerper, prpf2 antikoerper, DHX16 antikoerper, DKFZp459L1130 antikoerper, DBP2 antikoerper, DDX16 antikoerper, PRO2014 antikoerper, PRP8 antikoerper, PRPF2 antikoerper, Prp2 antikoerper, 2410006N22Rik antikoerper, Ddx16 antikoerper, mKIAA0577 antikoerper, Dbp2 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 16 antikoerper, DEAH-box helicase 16 antikoerper, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 antikoerper, dhx16 antikoerper, DHX16 antikoerper, LOC100637149 antikoerper, Dhx16 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
- Molekulargewicht
- 115 kDa (MW of target protein)
-