PCBP4 Antikörper

Produktnummer ABIN634227

Produktdetails anti-PCBP4 Antikörper

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCBP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCBP4 Blocking Peptide, catalog no. 33R-7763, is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCBP4

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Andere Bezeichnung: PCBP4 (PCBP4 Produkte)

Synonyme: Pcbp4 antikoerper, zgc:77347 antikoerper, wu:fc68f03 antikoerper, PCBP4 antikoerper, CBP antikoerper, LIP4 antikoerper, MCG10 antikoerper, 1200003L19Rik antikoerper, AlphaCP-4 antikoerper, poly(rC) binding protein 4 antikoerper, pcbp4 antikoerper, PCBP4 antikoerper, Pcbp4 antikoerper

Hintergrund: PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.

Molekulargewicht: 47 kDa (MW of target protein)