NDN Antikörper
-
- Target Alle NDN Antikörper anzeigen
- NDN (Necdin Homolog (Mouse) (NDN))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF
- Top Product
- Discover our top product NDN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDN (Necdin Homolog (Mouse) (NDN))
- Andere Bezeichnung
- NDN (NDN Produkte)
- Synonyme
- LOC574323 antikoerper, AI528698 antikoerper, Peg6 antikoerper, NDN antikoerper, HsT16328 antikoerper, PWCR antikoerper, necdin, MAGE family member antikoerper, necdin antikoerper, NDN antikoerper, Ndn antikoerper
- Hintergrund
- This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung
-