CDK5RAP1 Antikörper (N-Term)

Produktnummer ABIN634233

Produktdetails anti-CDK5RAP1 Antikörper

Target: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDK5RAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDK5 RAP1 antibody was raised against the N terminal of CDK5 AP1

Aufreinigung: Affinity purified

Immunogen: CDK5 RAP1 antibody was raised using the N terminal of CDK5 AP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDK5RAP1 Blocking Peptide, catalog no. 33R-6227, is also available for use as a blocking control in assays to test for specificity of this CDK5RAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDK0 AP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDK5RAP1

Target: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Andere Bezeichnung: CDK5RAP1 (CDK5RAP1 Produkte)

Synonyme: cdk5rap1 antikoerper, MGC154823 antikoerper, C20orf34 antikoerper, C42 antikoerper, CGI-05 antikoerper, HSPC167 antikoerper, 2310066P17Rik antikoerper, CDK5 regulatory subunit associated protein 1 antikoerper, CDK5 regulatory subunit associated protein 1 L homeolog antikoerper, CDK5RAP1 antikoerper, cdk5rap1 antikoerper, cdk5rap1.L antikoerper, Cdk5rap1 antikoerper

Hintergrund: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A.

Molekulargewicht: 55 kDa (MW of target protein)