CDK5RAP1 Antikörper (N-Term)
-
- Target Alle CDK5RAP1 Antikörper anzeigen
- CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDK5RAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDK5 RAP1 antibody was raised against the N terminal of CDK5 AP1
- Aufreinigung
- Affinity purified
- Immunogen
- CDK5 RAP1 antibody was raised using the N terminal of CDK5 AP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
- Top Product
- Discover our top product CDK5RAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDK5RAP1 Blocking Peptide, catalog no. 33R-6227, is also available for use as a blocking control in assays to test for specificity of this CDK5RAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDK0 AP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))
- Andere Bezeichnung
- CDK5RAP1 (CDK5RAP1 Produkte)
- Hintergrund
- Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A.
- Molekulargewicht
- 55 kDa (MW of target protein)
-