Kallikrein 10 Antikörper (N-Term)

Produktnummer ABIN634235

Produktdetails anti-Kallikrein 10 Antikörper

Target: Kallikrein 10 (KLK10)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLK10 antibody was raised against the N terminal of KLK10

Aufreinigung: Affinity purified

Immunogen: KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 10

Target: Kallikrein 10 (KLK10)

Andere Bezeichnung: KLK10 (KLK10 Produkte)

Synonyme: KLK10 antikoerper, 2300002A13Rik antikoerper, NES1 antikoerper, PRSSL1 antikoerper, kallikrein related peptidase 10 antikoerper, kallikrein related-peptidase 10 antikoerper, kallikrein-related peptidase 10 antikoerper, KLK10 antikoerper, Klk10 antikoerper

Hintergrund: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Komplementsystem