TdT Antikörper (N-Term)

Produktnummer ABIN634239

Produktdetails anti-TdT Antikörper

Target: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TdT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DNTT antibody was raised against the N terminal of DNTT

Aufreinigung: Affinity purified

Immunogen: DNTT antibody was raised using the N terminal of DNTT corresponding to a region with amino acids FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNTT Blocking Peptide, catalog no. 33R-3028, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TdT

Target: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Andere Bezeichnung: DNTT (DNTT Produkte)

Synonyme: TdT antikoerper, TDT antikoerper, BB160593 antikoerper, Tdt antikoerper, dntt-A antikoerper, dntt antikoerper, DNA nucleotidylexotransferase antikoerper, deoxynucleotidyltransferase, terminal antikoerper, DNA nucleotidylexotransferase L homeolog antikoerper, terminal deoxynucleotidyl transferase antikoerper, DNTT antikoerper, dntt antikoerper, Dntt antikoerper, dntt.L antikoerper, tdt antikoerper

Hintergrund: DNTT is a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, DNTT is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor geneegments.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: DNA Reparatur