TLK1 Antikörper (N-Term)
-
- Target Alle TLK1 Antikörper anzeigen
- TLK1 (Tousled-Like Kinase 1 (TLK1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TLK1 antibody was raised against the N terminal of TLK1
- Aufreinigung
- Affinity purified
- Immunogen
- TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG
- Top Product
- Discover our top product TLK1 Primärantikörper
-
anti-Tousled-Like Kinase 1 (TLK1) (AA 720-750), (C-Term) antibody
TLK1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB3043 unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 111-230) antibodyTLK1 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 4B3 unconjugated
anti-Tousled-Like Kinase 1 (TLK1) antibodyTLK1 Reaktivität: Human WB, IF, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 160-230) antibodyTLK1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) antibodyTLK1 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 458-560) antibodyTLK1 Reaktivität: Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 701-728), (C-Term) antibodyTLK1 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB37154 unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 737-751), (Isoform 1) antibodyTLK1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (AA 1-766) antibodyTLK1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Tousled-Like Kinase 1 (TLK1) (C-Term) antibodyTLK1 Reaktivität: Human, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TLK1 Blocking Peptide, catalog no. 33R-2724, is also available for use as a blocking control in assays to test for specificity of this TLK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TLK1 (Tousled-Like Kinase 1 (TLK1))
- Andere Bezeichnung
- TLK1 (TLK1 Produkte)
- Synonyme
- PKU-beta antikoerper, 4930545J15Rik antikoerper, fe11e12 antikoerper, si:dkey-251e16.4 antikoerper, tlk1 antikoerper, wu:fe11e12 antikoerper, TLK1 antikoerper, fb76h12 antikoerper, si:dkey-88m1.1 antikoerper, wu:fb76h12 antikoerper, DKFZp459L163 antikoerper, tousled like kinase 1 antikoerper, tousled-like kinase 1 antikoerper, tousled-like kinase 1b antikoerper, tousled like kinase 1 like antikoerper, serine/threonine-protein kinase TOUSLED antikoerper, tousled-like kinase 1a antikoerper, Serine/threonine-protein kinase tousled-like 1 antikoerper, TLK1 antikoerper, Tlk1 antikoerper, tlk1b antikoerper, TLK1L antikoerper, LOC542181 antikoerper, tlk1a antikoerper, tlk1 antikoerper, tlk-1 antikoerper
- Hintergrund
- The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.
- Molekulargewicht
- 84 kDa (MW of target protein)
-
