MAPK13 Antikörper (Middle Region)
-
- Target Alle MAPK13 Antikörper anzeigen
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAPK13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAPK13 antibody was raised against the middle region of MAPK13
- Aufreinigung
- Affinity purified
- Immunogen
- MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
- Top Product
- Discover our top product MAPK13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
- Andere Bezeichnung
- MAPK13 (MAPK13 Produkte)
- Synonyme
- F24B9.3 antikoerper, F24B9_3 antikoerper, MAPK 13 antikoerper, MAPK-13 antikoerper, PRKM13 antikoerper, SAPK4 antikoerper, p38delta antikoerper, Serk4 antikoerper, Prkm13 antikoerper, sapk4 antikoerper, prkm13 antikoerper, Protein kinase superfamily protein antikoerper, mitogen-activated protein kinase 13 antikoerper, mitogen activated protein kinase 13 antikoerper, ATMPK13 antikoerper, MAPK13 antikoerper, Mapk13 antikoerper, mapk13 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- MAPK Signalweg, Neurotrophin Signalübertragung, Hepatitis C, BCR Signaling, S100 Proteine
-