Estrogen Receptor alpha Antikörper (Middle Region)
-
- Target Alle Estrogen Receptor alpha (ESR1) Antikörper anzeigen
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Estrogen Receptor alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Estrogen Receptor 1 antibody was raised against the middle region of ESR1
- Aufreinigung
- Affinity purified
- Immunogen
- Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
- Top Product
- Discover our top product ESR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
- Andere Bezeichnung
- Estrogen Receptor 1 (ESR1 Produkte)
- Synonyme
- LOC398734 antikoerper, AA420328 antikoerper, AU041214 antikoerper, ER-alpha antikoerper, ER[a] antikoerper, ERa antikoerper, ERalpha antikoerper, ESR antikoerper, Estr antikoerper, Estra antikoerper, Nr3a1 antikoerper, NR3A1 antikoerper, eralpha antikoerper, zfER[a] antikoerper, ER antikoerper, ESRA antikoerper, ESTRR antikoerper, Era antikoerper, akap12 antikoerper, cb27 antikoerper, esr1 antikoerper, fb72g12 antikoerper, id:ibd1202 antikoerper, sb:cb27 antikoerper, si:ch73-192g21.1 antikoerper, wu:fb72g12 antikoerper, wu:fc21c03 antikoerper, Esr antikoerper, RNESTROR antikoerper, ERALPHA antikoerper, er antikoerper, esr antikoerper, nr3a1 antikoerper, XER antikoerper, era antikoerper, esra antikoerper, ERbeta antikoerper, xesr-1 antikoerper, xlERalpha1 antikoerper, xlERalpha2 antikoerper, ESR1 antikoerper, estrogen receptor 1 L homeolog antikoerper, estrogen receptor 1 (alpha) antikoerper, estrogen receptor 1 antikoerper, A kinase (PRKA) anchor protein 12b antikoerper, esr1.L antikoerper, Esr1 antikoerper, ESR1 antikoerper, esr1 antikoerper, akap12b antikoerper
- Hintergrund
- Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
- Molekulargewicht
- 66 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-