Presenilin 2 Antikörper
-
- Target Alle Presenilin 2 (PSEN2) Antikörper anzeigen
- Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Presenilin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
- Top Product
- Discover our top product PSEN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Presenilin 2 Blocking Peptide, catalog no. 33R-9902, is also available for use as a blocking control in assays to test for specificity of this Presenilin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))
- Andere Bezeichnung
- Presenilin 2 (PSEN2 Produkte)
- Hintergrund
- Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Notch Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung
-