JAG2 Antikörper (N-Term)

Produktnummer ABIN634269

Produktdetails anti-JAG2 Antikörper

Target: JAG2 (Jagged 2 (JAG2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JAG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Jagged 2 antibody was raised against the N terminal of JAG2

Aufreinigung: Affinity purified

Immunogen: Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Jagged 2 Blocking Peptide, catalog no. 33R-7820, is also available for use as a blocking control in assays to test for specificity of this Jagged 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JAG2

Target: JAG2 (Jagged 2 (JAG2))

Andere Bezeichnung: Jagged 2 (JAG2 Produkte)

Synonyme: D12Ggc2e antikoerper, Serh antikoerper, mJagged2-1 antikoerper, sm antikoerper, HJ2 antikoerper, SER2 antikoerper, jag2 antikoerper, serB antikoerper, zgc:152855 antikoerper, jagged 2 antikoerper, jagged 2b antikoerper, JAG2 antikoerper, jag2 antikoerper, Jag2 antikoerper, jag2b antikoerper

Hintergrund: The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.

Molekulargewicht: 130 kDa (MW of target protein)

Pathways: Notch Signalweg, Sensory Perception of Sound