SUN2 Antikörper
-
- Target Alle SUN2 Antikörper anzeigen
- SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SUN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM
- Top Product
- Discover our top product SUN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UNC84B Blocking Peptide, catalog no. 33R-8772, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))
- Andere Bezeichnung
- UNC84B (SUN2 Produkte)
- Hintergrund
- UNC84B may form a physical interaction between the nuclear envelope and the centrosome.
- Molekulargewicht
- 80 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion
-