FICD Antikörper (C-Term)
-
- Target Alle FICD Antikörper anzeigen
- FICD (FIC Domain Containing (FICD))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FICD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- FICD antibody was raised against the C terminal of FICD
- Aufreinigung
- Affinity purified
- Immunogen
- FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP
- Top Product
- Discover our top product FICD Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FICD Blocking Peptide, catalog no. 33R-3215, is also available for use as a blocking control in assays to test for specificity of this FICD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FICD (FIC Domain Containing (FICD))
- Andere Bezeichnung
- FICD (FICD Produkte)
- Synonyme
- HIP13 antikoerper, HYPE antikoerper, UNQ3041 antikoerper, D5Ertd40e antikoerper, Hype antikoerper, FIC domain containing antikoerper, FICD antikoerper, Ficd antikoerper
- Hintergrund
- FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
- Molekulargewicht
- 52 kDa (MW of target protein)
-