RFT1 Antikörper
-
- Target Alle RFT1 Antikörper anzeigen
- RFT1 (RFT1 Homolog (RFT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RFT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
- Top Product
- Discover our top product RFT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFT1 (RFT1 Homolog (RFT1))
- Andere Bezeichnung
- RFT1 (RFT1 Produkte)
- Synonyme
- GB14370 antikoerper, CDG1N antikoerper, D930025H04 antikoerper, RGD1562654 antikoerper, protein RFT1 homolog antikoerper, RFT1 homolog antikoerper, LOC412489 antikoerper, LOC100453537 antikoerper, RFT1 antikoerper, rft1 antikoerper, LOC100633251 antikoerper, LOC100651701 antikoerper, Rft1 antikoerper
- Hintergrund
- N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.
- Molekulargewicht
- 60 kDa (MW of target protein)
-