DUSP8 Antikörper (Middle Region)

Produktnummer ABIN634286

Produktdetails anti-DUSP8 Antikörper

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUSP8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DUSP8 antibody was raised against the middle region of DUSP8

Aufreinigung: Affinity purified

Immunogen: DUSP8 antibody was raised using the middle region of DUSP8 corresponding to a region with amino acids PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUSP8 Blocking Peptide, catalog no. 33R-6973, is also available for use as a blocking control in assays to test for specificity of this DUSP8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUSP8

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Andere Bezeichnung: DUSP8 (DUSP8 Produkte)

Synonyme: zgc:77593 antikoerper, C11orf81 antikoerper, HB5 antikoerper, HVH-5 antikoerper, HVH8 antikoerper, 5530400B01Rik antikoerper, AI593498 antikoerper, Nttp1 antikoerper, Hb5 antikoerper, M3/6 antikoerper, DUSP8 antikoerper, dual specificity phosphatase 8 antikoerper, dual specificity phosphatase 8a antikoerper, dual specificity protein phosphatase 8 antikoerper, DUSP8 antikoerper, dusp8 antikoerper, dusp8a antikoerper, DSP8 antikoerper, Dusp8 antikoerper, LOC615727 antikoerper

Hintergrund: DUSP8 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.

Molekulargewicht: 66 kDa (MW of target protein)