GRF2 Antikörper
-
- Target Alle GRF2 (RAPGEF1) Antikörper anzeigen
- GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK
- Top Product
- Discover our top product RAPGEF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAPGEF1 Blocking Peptide, catalog no. 33R-5553, is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))
- Andere Bezeichnung
- RAPGEF1 (RAPGEF1 Produkte)
- Hintergrund
- RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.
- Molekulargewicht
- 120 kDa (MW of target protein)
- Pathways
- Interferon-gamma Pathway, Neurotrophin Signalübertragung, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor
-