GRF2 Antikörper

Produktnummer ABIN634290

Produktdetails anti-GRF2 Antikörper

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAPGEF1 Blocking Peptide, catalog no. 33R-5553, is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRF2

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Andere Bezeichnung: RAPGEF1 (RAPGEF1 Produkte)

Synonyme: C3G antikoerper, GRF2 antikoerper, Link-GEFII antikoerper, 4932418O06Rik antikoerper, Grf2 antikoerper, RAPGEF1 antikoerper, C3G-1 antikoerper, C3G-2 antikoerper, C3g antikoerper, rapgef1 antikoerper, zgc:56372 antikoerper, Rap guanine nucleotide exchange factor 1 antikoerper, Rap guanine nucleotide exchange factor like 1 antikoerper, Rap guanine nucleotide exchange factor (GEF) 1 antikoerper, Rap guanine nucleotide exchange factor 1 S homeolog antikoerper, Rap guanine nucleotide exchange factor (GEF) 1b antikoerper, RAPGEF1 antikoerper, RAPGEFL1 antikoerper, Rapgef1 antikoerper, rapgef1.S antikoerper, rapgef1 antikoerper, rapgef1b antikoerper, Rapgefl1 antikoerper

Hintergrund: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.

Molekulargewicht: 120 kDa (MW of target protein)

Pathways: Interferon-gamma Pathway, Neurotrophin Signalübertragung, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor