RGS3 Antikörper (C-Term)

Produktnummer ABIN634296

Produktdetails anti-RGS3 Antikörper

Target: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RGS3 antibody was raised against the C terminal of RGS3

Aufreinigung: Affinity purified

Immunogen: RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS3 Blocking Peptide, catalog no. 33R-4300, is also available for use as a blocking control in assays to test for specificity of this RGS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS3

Target: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Andere Bezeichnung: RGS3 (RGS3 Produkte)

Synonyme: RGS3 antikoerper, MGC115680 antikoerper, C2PA antikoerper, RGP3 antikoerper, 4930506N09Rik antikoerper, C2PA-RGS3 antikoerper, C2pa antikoerper, PDZ-RGS3 antikoerper, RGS3S antikoerper, SRB-RGS antikoerper, regulator of G protein signaling 3 antikoerper, regulator of G-protein signaling 3 L homeolog antikoerper, regulator of G-protein signaling 3 antikoerper, RGS3 antikoerper, rgs3.L antikoerper, Rgs3 antikoerper

Hintergrund: RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Molekulargewicht: 101 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling