CHN1 Antikörper
-
- Target Alle CHN1 (ARHGAP2) Antikörper anzeigen
- CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
- Top Product
- Discover our top product ARHGAP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHN1 Blocking Peptide, catalog no. 33R-4728, is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))
- Andere Bezeichnung
- CHN1 (ARHGAP2 Produkte)
- Synonyme
- ARHGAP2 antikoerper, CHN antikoerper, DURS2 antikoerper, NC antikoerper, RHOGAP2 antikoerper, 0610007I19Rik antikoerper, 0710001E19Rik antikoerper, 1700112L09Rik antikoerper, 2900046J01Rik antikoerper, AI413815 antikoerper, chimaerin antikoerper, wu:fr89a09 antikoerper, zgc:56160 antikoerper, zgc:92906 antikoerper, N-chimaerin antikoerper, chimerin 1 antikoerper, chimerin 1 L homeolog antikoerper, CHN1 antikoerper, Chn1 antikoerper, chn1.L antikoerper, chn1 antikoerper
- Hintergrund
- CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.
- Molekulargewicht
- 53 kDa (MW of target protein)
-