B-Cell Linker Antikörper (Middle Region)
-
- Target Alle B-Cell Linker (BLNK) Antikörper anzeigen
- B-Cell Linker (BLNK)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B-Cell Linker Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BLNK antibody was raised against the middle region of BLNK
- Aufreinigung
- Affinity purified
- Immunogen
- BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
- Top Product
- Discover our top product BLNK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B-Cell Linker (BLNK)
- Andere Bezeichnung
- BLNK (BLNK Produkte)
- Synonyme
- BLNK antikoerper, blnk antikoerper, MGC147045 antikoerper, BASH antikoerper, Bca antikoerper, Ly-57 antikoerper, Ly57 antikoerper, Lyw-57 antikoerper, SLP-65 antikoerper, AGM4 antikoerper, BLNK-S antikoerper, LY57 antikoerper, SLP65 antikoerper, bca antikoerper, B-cell linker antikoerper, B cell linker antikoerper, BLNK antikoerper, blnk antikoerper, Blnk antikoerper
- Hintergrund
- This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- BCR Signaling
-