RASGEF1A Antikörper (N-Term)

Produktnummer ABIN634311

Produktdetails anti-RASGEF1A Antikörper

Target: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASGEF1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RASGEF1 A antibody was raised against the N terminal of RASGEF1

Aufreinigung: Affinity purified

Immunogen: RASGEF1 A antibody was raised using the N terminal of RASGEF1 corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASGEF1A Blocking Peptide, catalog no. 33R-9069, is also available for use as a blocking control in assays to test for specificity of this RASGEF1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASGEF1A

Target: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Andere Bezeichnung: RASGEF1A (RASGEF1A Produkte)

Synonyme: MGC84301 antikoerper, CG4853 antikoerper, 6330404M18Rik antikoerper, AI835194 antikoerper, RasGEF domain family member 1A antikoerper, RasGEF domain family member 1A L homeolog antikoerper, RasGEF domain family, member 1A antikoerper, RASGEF1A antikoerper, rasgef1a.L antikoerper, rasgef1a antikoerper, Rasgef1a antikoerper

Hintergrund: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Molekulargewicht: 54 kDa (MW of target protein)