C4BPA Antikörper (Middle Region)
-
- Target Alle C4BPA Antikörper anzeigen
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C4BPA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C4 BPA antibody was raised against the middle region of C4 PA
- Aufreinigung
- Affinity purified
- Immunogen
- C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
- Top Product
- Discover our top product C4BPA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
- Andere Bezeichnung
- C4BPA (C4BPA Produkte)
- Synonyme
- CRES antikoerper, c4bp antikoerper, C4BP antikoerper, PRP antikoerper, complement component 4 binding protein, alpha chain antikoerper, C4b-binding protein alpha chain antikoerper, complement component 4 binding protein alpha antikoerper, complement component 4 binding protein, alpha antikoerper, LOC419851 antikoerper, c4bp antikoerper, C4BPA antikoerper, C4bpa antikoerper
- Hintergrund
- C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Komplementsystem
-