STAMBP Antikörper (N-Term)
-
- Target Alle STAMBP Antikörper anzeigen
- STAMBP (STAM Binding Protein (STAMBP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAMBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STAMBP antibody was raised against the N terminal of STAMBP
- Aufreinigung
- Affinity purified
- Immunogen
- STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
- Top Product
- Discover our top product STAMBP Primärantikörper
-
anti-STAM Binding Protein (STAMBP) antibody
STAMBP Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 100-270) antibodySTAMBP Reaktivität: Human WB, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 355-383), (C-Term) antibodySTAMBP Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB32017 unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 1-424) antibodySTAMBP Reaktivität: Human ELISA, IF Wirt: Maus Monoclonal 1A8 unconjugated
anti-STAM Binding Protein (STAMBP) antibodySTAMBP Reaktivität: Human, Maus, Ratte WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (AA 362-391), (C-Term) antibodySTAMBP Reaktivität: Human, Maus WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) (C-Term) antibodySTAMBP Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein (STAMBP) antibodySTAMBP Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STAMBP Blocking Peptide, catalog no. 33R-8355, is also available for use as a blocking control in assays to test for specificity of this STAMBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STAMBP (STAM Binding Protein (STAMBP))
- Andere Bezeichnung
- STAMBP (STAMBP Produkte)
- Synonyme
- AMSH antikoerper, 5330424L14Rik antikoerper, 5730422L11Rik antikoerper, AW107289 antikoerper, Amsh antikoerper, mKIAA4198 antikoerper, stambp antikoerper, zgc:66147 antikoerper, STAM binding protein antikoerper, Stam binding protein antikoerper, STAM binding protein a antikoerper, STAMBP antikoerper, Stambp antikoerper, stambpa antikoerper
- Hintergrund
- Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.
- Molekulargewicht
- 48 kDa (MW of target protein)
-
