C4B Antikörper

Produktnummer ABIN634315

Produktdetails anti-C4B Antikörper

Target: C4B (C4b) (Complement Component C4b (C4b))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C4B

Target: C4B (C4b) (Complement Component C4b (C4b))

Andere Bezeichnung: Complement C4b (C4b Produkte)

Synonyme: C4B1 antikoerper, C4B12 antikoerper, C4B2 antikoerper, C4B3 antikoerper, C4B5 antikoerper, C4BD antikoerper, C4B_2 antikoerper, C4F antikoerper, CH antikoerper, CO4 antikoerper, CPAMD3 antikoerper, C4 antikoerper, C4A2 antikoerper, C4A3 antikoerper, C4A4 antikoerper, C4A6 antikoerper, C4AD antikoerper, C4S antikoerper, CPAMD2 antikoerper, RG antikoerper, wu:fi14a03 antikoerper, C4B antikoerper, DKFZP469I0332 antikoerper, Slp antikoerper, Ss antikoerper, C4-2 antikoerper, C4l antikoerper, complement C4B (Chido blood group) antikoerper, complement C4A (Rodgers blood group) antikoerper, complement component 4 antikoerper, complement C4-B antikoerper, complement component 4B (Chido blood group) antikoerper, complement component 4A (Rodgers blood group) antikoerper, C4B antikoerper, C4A antikoerper, c4 antikoerper, LOC462577 antikoerper, C4a antikoerper, C4b antikoerper

Hintergrund: C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Komplementsystem