UBD Antikörper (N-Term)

Produktnummer ABIN634317

Produktdetails anti-UBD Antikörper

Target: UBD (Ubiquitin D (UBD))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ubiquitin D antibody was raised against the N terminal of UBD

Aufreinigung: Affinity purified

Immunogen: Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBD

Target: UBD (Ubiquitin D (UBD))

Andere Bezeichnung: Ubiquitin D (UBD Produkte)

Synonyme: FAT10 antikoerper, GABBR1 antikoerper, UBD-3 antikoerper, ubiquitin D antikoerper, UBD antikoerper, Ubd antikoerper

Hintergrund: UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway