SNX5 Antikörper (N-Term)

Produktnummer ABIN634321

Produktdetails anti-SNX5 Antikörper

Target: SNX5 (Sorting Nexin 5 (SNX5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SNX5 antibody was raised against the N terminal of SNX5

Aufreinigung: Affinity purified

Immunogen: SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNX5 Blocking Peptide, catalog no. 33R-3126, is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNX5

Target: SNX5 (Sorting Nexin 5 (SNX5))

Andere Bezeichnung: SNX5 (SNX5 Produkte)

Synonyme: 0910001N05Rik antikoerper, 1810032P22Rik antikoerper, AU019504 antikoerper, D2Ertd52e antikoerper, id:ibd5091 antikoerper, wu:fa66c10 antikoerper, wu:fi28h04 antikoerper, zgc:55769 antikoerper, SNX5 antikoerper, snx5 antikoerper, sorting nexin 5 antikoerper, sorting nexin 5 S homeolog antikoerper, SNX5 antikoerper, Snx5 antikoerper, snx5.S antikoerper, snx5 antikoerper

Hintergrund: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

Molekulargewicht: 47 kDa (MW of target protein)