SNX5 Antikörper (N-Term)
-
- Target Alle SNX5 Antikörper anzeigen
- SNX5 (Sorting Nexin 5 (SNX5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNX5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNX5 antibody was raised against the N terminal of SNX5
- Aufreinigung
- Affinity purified
- Immunogen
- SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF
- Top Product
- Discover our top product SNX5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNX5 Blocking Peptide, catalog no. 33R-3126, is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNX5 (Sorting Nexin 5 (SNX5))
- Andere Bezeichnung
- SNX5 (SNX5 Produkte)
- Hintergrund
- SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.
- Molekulargewicht
- 47 kDa (MW of target protein)
-