RGS19 Antikörper (N-Term)
-
- Target Alle RGS19 Antikörper anzeigen
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RGS19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RGS19 antibody was raised against the N terminal of RGS19
- Aufreinigung
- Affinity purified
- Immunogen
- RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
- Top Product
- Discover our top product RGS19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RGS19 Blocking Peptide, catalog no. 33R-7391, is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
- Andere Bezeichnung
- RGS19 (RGS19 Produkte)
- Synonyme
- RGS19 antikoerper, GAIP antikoerper, RGSGAIP antikoerper, 2610042F04Rik antikoerper, AI324841 antikoerper, AW547781 antikoerper, Camki antikoerper, Gaip antikoerper, regulator of G protein signaling 19 antikoerper, regulator of G-protein signaling 19 antikoerper, RGS19 antikoerper, Rgs19 antikoerper
- Hintergrund
- G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-