RHOC Antikörper (N-Term)

Produktnummer ABIN634331

Produktdetails anti-RHOC Antikörper

Target: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHOC antibody was raised against the N terminal of RHOC

Aufreinigung: Affinity purified

Immunogen: RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOC

Target: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Andere Bezeichnung: RHOC (RHOC Produkte)

Synonyme: ARHC antikoerper, LOC100221682 antikoerper, ARH9 antikoerper, H9 antikoerper, RHOH9 antikoerper, AI324259 antikoerper, Arh9 antikoerper, Arhc antikoerper, CRHOC antikoerper, ras homolog family member C L homeolog antikoerper, ras homolog family member C antikoerper, rhoc.L antikoerper, RHOC antikoerper, rhoc antikoerper, Rhoc antikoerper

Hintergrund: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: WNT Signalweg, Cell-Cell Junction Organization