RHOC Antikörper (N-Term)
-
- Target Alle RHOC Antikörper anzeigen
- RHOC (Ras Homolog Gene Family, Member C (RHOC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHOC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RHOC antibody was raised against the N terminal of RHOC
- Aufreinigung
- Affinity purified
- Immunogen
- RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
- Top Product
- Discover our top product RHOC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOC (Ras Homolog Gene Family, Member C (RHOC))
- Andere Bezeichnung
- RHOC (RHOC Produkte)
- Hintergrund
- RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Cell-Cell Junction Organization
-