SNX18 Antikörper (N-Term)
-
- Target Alle SNX18 Antikörper anzeigen
- SNX18 (Sorting Nexin 18 (SNX18))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNX18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNAG1 antibody was raised against the N terminal Of Snag1
- Aufreinigung
- Affinity purified
- Immunogen
- SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
- Top Product
- Discover our top product SNX18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNAG1 Blocking Peptide, catalog no. 33R-5183, is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNX18 (Sorting Nexin 18 (SNX18))
- Andere Bezeichnung
- SNAG1 (SNX18 Produkte)
- Synonyme
- snag1 antikoerper, MGC82637 antikoerper, SNX18 antikoerper, SNAG1 antikoerper, si:dkey-193c22.4 antikoerper, SH3PX2 antikoerper, SH3PXD3B antikoerper, Snag1 antikoerper, sorting nexin 18 L homeolog antikoerper, sorting nexin 18 antikoerper, sorting nexin 18 S homeolog antikoerper, sorting nexin 18a antikoerper, snx18.L antikoerper, SNX18 antikoerper, snx18.S antikoerper, snx18 antikoerper, snx18a antikoerper, Snx18 antikoerper
- Hintergrund
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.
- Molekulargewicht
- 69 kDa (MW of target protein)
-