RHOD Antikörper (C-Term)

Produktnummer ABIN634339

Produktdetails anti-RHOD Antikörper

Target: RHOD (Ras Homolog Family Member D (RHOD))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHOD antibody was raised against the C terminal of RHOD

Aufreinigung: Affinity purified

Immunogen: RHOD antibody was raised using the C terminal of RHOD corresponding to a region with amino acids NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOD Blocking Peptide, catalog no. 33R-6707, is also available for use as a blocking control in assays to test for specificity of this RHOD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOD

Target: RHOD (Ras Homolog Family Member D (RHOD))

Andere Bezeichnung: RHOD (RHOD Produkte)

Synonyme: ARHD antikoerper, RHOHP1 antikoerper, RHOM antikoerper, Rho antikoerper, AI326383 antikoerper, Arhd antikoerper, RhoHP1 antikoerper, RhoM antikoerper, ras homolog family member D antikoerper, RHOD antikoerper, Rhod antikoerper

Hintergrund: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation.

Molekulargewicht: 23 kDa (MW of target protein)