WNK3 Antikörper (N-Term)

Produktnummer ABIN634341

Produktdetails anti-WNK3 Antikörper

Target: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNK3 antibody was raised against the N terminal of WNK3

Aufreinigung: Affinity purified

Immunogen: WNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNK3 Blocking Peptide, catalog no. 33R-10032, is also available for use as a blocking control in assays to test for specificity of this WNK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNK3

Target: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Andere Bezeichnung: WNK3 (WNK3 Produkte)

Synonyme: fc63h12 antikoerper, PRKWNK3 antikoerper, Prkwnk3 antikoerper, Wnk3-ps antikoerper, RGD1563131 antikoerper, wu:fc63h12 antikoerper, WNK lysine deficient protein kinase 3 antikoerper, wu:fc63h12 antikoerper, LOC100363278 antikoerper, WNK3 antikoerper, Wnk3 antikoerper

Hintergrund: Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases that lack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.

Molekulargewicht: 192 kDa (MW of target protein)