STK38 Antikörper (C-Term)
-
- Target Alle STK38 Antikörper anzeigen
- STK38 (serine/threonine Kinase 38 (STK38))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STK38 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STK38 antibody was raised against the C terminal of STK38
- Aufreinigung
- Affinity purified
- Immunogen
- STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
- Top Product
- Discover our top product STK38 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK38 (serine/threonine Kinase 38 (STK38))
- Andere Bezeichnung
- STK38 (STK38 Produkte)
- Hintergrund
- STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
- Molekulargewicht
- 54 kDa (MW of target protein)
-