TAB1 Antikörper (N-Term)
-
- Target Alle TAB1 Antikörper anzeigen
- TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TAB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1
- Aufreinigung
- Affinity purified
- Immunogen
- MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE
- Top Product
- Discover our top product TAB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))
- Andere Bezeichnung
- MAP3K7IP1 (TAB1 Produkte)
- Hintergrund
- The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades
-