RAB18 Antikörper (C-Term)
-
- Target Alle RAB18 Antikörper anzeigen
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB18 antibody was raised against the C terminal of RAB18
- Aufreinigung
- Affinity purified
- Immunogen
- RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG
- Top Product
- Discover our top product RAB18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB18 Blocking Peptide, catalog no. 33R-4939, is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
- Andere Bezeichnung
- RAB18 (RAB18 Produkte)
- Hintergrund
- RAB18 belongs to the small GTPase superfamily.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-